PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A13G0538
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 297aa    MW: 31451.6 Da    PI: 6.7473
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A13G0538genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.29e-091154344
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                      W+   d  + +a + ++ +   +W++Ia+ ++ g+tl+++k+++
      Gh_A13G0538 11 EWSRGQDRAFENALATYPEDsadRWEKIAADVP-GKTLEEIKEHY 54
                     79999****************************.**********9 PP

2Myb_DNA-binding422.2e-13122166347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
      Gh_A13G0538 122 AWTEDEHRLFLLGLDKYGKGDWRSISRNFVVTRTPTQVASHAQKY 166
                      6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.636762IPR017884SANT domain
SMARTSM007173.0E-8860IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-41164IPR009057Homeodomain-like
PfamPF002493.6E-61154IPR001005SANT/Myb domain
SuperFamilySSF466891.39E-101165IPR009057Homeodomain-like
CDDcd001677.76E-81157No hitNo description
PROSITE profilePS5129417.581114171IPR017930Myb domain
SuperFamilySSF466891.27E-16117172IPR009057Homeodomain-like
SMARTSM007173.2E-10119169IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.6E-17119169IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.4E-10122165IPR009057Homeodomain-like
PfamPF002492.7E-11122166IPR001005SANT/Myb domain
CDDcd001678.54E-10122167No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MTVEEAGNSS EWSRGQDRAF ENALATYPED SADRWEKIAA DVPGKTLEEI KEHYELLEDD  60
INQIESGCVP LPPYDSSDGS AGHAGDEGTG KKGSSNLGHY NSESNQGSKS SRSDQERRKG  120
IAWTEDEHRL FLLGLDKYGK GDWRSISRNF VVTRTPTQVA SHAQKYFIRL NSMNKDRRRS  180
SIHDITSVGN ADISAPQGPI TGQTNGAAAG GSSGKSAKQP PQHPAALAGV GVYGAPTMGQ  240
PIGGGPLVSA VGTPVNLPAQ AHMAYGVRAS VPGAVVHGAP MNMGPATYPI PHTSAHR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A6e-18780679RADIALIS
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.59330.0boll| ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012463576.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_012463577.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_012463578.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_012463579.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_012463580.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H72e-65DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0B0PER00.0A0A0B0PER0_G
STRINGGLYMA07G28310.11e-168(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35562861
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-127MYB family protein